PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03738
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 497aa    MW: 53554.3 Da    PI: 7.5159
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03738genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.53e-38120180262
    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
               ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt+GG++rn+PvG+grrk+k+ss
  EMT03738 120 PDKILPCPRCNSMDTKFCYYNNYNIHQPRHFCRGCQRYWTAGGSMRNLPVGAGRRKSKSSS 180
               7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29117177IPR003851Zinc finger, Dof-type
PfamPF027012.9E-31122178IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.127124178IPR003851Zinc finger, Dof-type
PROSITE patternPS013610126162IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSYIMLCLIL VRLFKLAASY KIEHRYRDDV CQLIIARLAY HTVHGQDSCK DTGDTRITEE  60
NSCTPPDLNL SQPNNSGLNS SSACENQTSN GDEMTEPEST LEAAKTEGDG SNKEKVLKKP  120
DKILPCPRCN SMDTKFCYYN NYNIHQPRHF CRGCQRYWTA GGSMRNLPVG AGRRKSKSSS  180
TNCNGILIPG GSLAAPGGDS SVIPLPIKEN QPAVKFGSDS TLPNSMASLL RVEEQNKNSN  240
PASTAHPRNG ENQTCPPSAT TSDNPRIESV KAAVGVHQNG ITGDCNGVTP MPPIPCFPGP  300
PFMYPWNPAW NGVPAMAAPV CPVPAEPANC SENGHGGNIQ WNFPPMVPMP GFCGPPIPFP  360
LMPPSVWPLV SPWPNGAWSA PWLGPSYSMS AAPPTSSSTC SDSGSPVLGK HPRDSDPRGG  420
EKAEKSLWIP KTLRIDDPDE AAKSSIWTTL GIEPGERGMF RAFQPKSGGR EQMSNAARVM  480
QANPAAQSRF ASFQETT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3588050.0AK358805.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1083I10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233788.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLM8BAI00.0M8BAI0_AEGTA; Dof zinc finger protein
STRINGMLOC_19593.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-41cycling DOF factor 2